PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013919-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 723aa    MW: 79342.9 Da    PI: 5.4373
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013919-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-1961116156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++e+e++F+++++p+ ++r+eL+++l L+  qVk+WFqN+R+++k
  AHYPO_013919-RA  61 KKRYHRHTQHQIQEMENFFKECPHPDDKQRKELSRRLALEPLQVKFWFQNKRTQMK 116
                      688999***********************************************998 PP

2START2122.2e-662544741206
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela +a++el+++a+++ep+Wv s+    e++n++e+ ++f+++ +      ++ea+r+s+vv+m++++l e+l+d++ qW+  +     +a+t
  AHYPO_013919-RA 254 ELAVAAMEELIQMAQSGEPLWVPSPdnstEILNEEEYFRSFPRGIGpmqlgLKSEASRDSAVVIMNHMNLIEILMDVN-QWSCVFSgivsRAMT 346
                      57899**************************************999********************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                      l+v+s+g      galq+m+ae+q++splvp R+  fvRy+++  + +wv+vdvS+d  ++ p    + R++++pSg+li++++ng+skvtwve
  AHYPO_013919-RA 347 LDVLSTGvagnynGALQVMTAEFQVPSPLVPtRENFFVRYCKKNVDNSWVVVDVSLDGLRPSP----IPRCRRRPSGCLIQELPNGYSKVTWVE 436
                      *************************************************************99....6************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      hv+++++ +h+++r lv+sgla+gak+wv+tl+ qce+
  AHYPO_013919-RA 437 HVEVDDQAVHNIYRALVNSGLAFGAKRWVSTLDMQCER 474
                      ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.46E-1848118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2049116IPR009057Homeodomain-like
PROSITE profilePS5007116.48758118IPR001356Homeobox domain
SMARTSM003895.4E-1759122IPR001356Homeobox domain
PfamPF000467.3E-1761116IPR001356Homeobox domain
CDDcd000861.08E-1761119No hitNo description
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PROSITE profilePS5084844.378245477IPR002913START domain
SuperFamilySSF559616.99E-36246476No hitNo description
CDDcd088751.22E-124249473No hitNo description
SMARTSM002348.0E-71254474IPR002913START domain
PfamPF018523.3E-55255474IPR002913START domain
Gene3DG3DSA:3.30.530.201.8E-5350468IPR023393START-like domain
SuperFamilySSF559611.26E-22495714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MYQPNMFETH HQLLDMGGGH KNPDSDLGKM RDDEFESSRS ATENLEGLSG DDQDPNQRPK  60
KKRYHRHTQH QIQEMENFFK ECPHPDDKQR KELSRRLALE PLQVKFWFQN KRTQMKAQHE  120
RSENQQLRSE NEKLRADNIR YKEALNNATC PNCGGPAAIG EMSFDEQQLR IENARLREEI  180
DRISGIAAKY VGKPLVTFPH LQNQGLHSRS SLDLGVGSFG APSSMVSDIY GGSAGDLLRS  240
VAPLTEADKP MIIELAVAAM EELIQMAQSG EPLWVPSPDN STEILNEEEY FRSFPRGIGP  300
MQLGLKSEAS RDSAVVIMNH MNLIEILMDV NQWSCVFSGI VSRAMTLDVL STGVAGNYNG  360
ALQVMTAEFQ VPSPLVPTRE NFFVRYCKKN VDNSWVVVDV SLDGLRPSPI PRCRRRPSGC  420
LIQELPNGYS KVTWVEHVEV DDQAVHNIYR ALVNSGLAFG AKRWVSTLDM QCERLASVMA  480
NNIPLTEGGV ITSAEGRKSM LKLAERMVMS FCAGVGASTA HTWTTLSGSG VDDVRVMTRK  540
SMDDPGRPPG IVLSAATSFW MPVSPKRVFD FLRDENSRSE WDILSNGGLV QEMAHIANGR  600
DPGNYSANSS QSNMLILQES TTDATGSYVI YAPVDIVAMN VVLNGGDPDY VALLPSGFAI  660
LPDGSVGSMD LGSGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIKCTV ERIKAAVAGD  720
TA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010665524.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_010665525.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A0K9R0U50.0A0A0K9R0U5_SPIOL; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein